SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008528 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008528
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-29
Family Spermadhesin, CUB domain 0.0000853
Further Details:      
 
Domain Number 2 Region: 130-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000461
Family EGF-type module 0.00094
Further Details:      
 
Domain Number 3 Region: 162-199
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000877
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008528   Gene: ENSMMUG00000006470   Transcript: ENSMMUT00000009076
Sequence length 199
Comment pep:known_by_projection chromosome:MMUL_1:11:7368283:7397821:-1 gene:ENSMMUG00000006470 transcript:ENSMMUT00000009076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFGEVTSPLFPKPYPNSFETTTMITVPTGYGVKLIFQHFDLEPSEGCSYDYVEVISADTK
NLGRFCGQLGSPLGNPPGKKEFISQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAEKI
AHDLRFVRLPCQHLCHNYVGGYFCSCRPGYELQEDRHSCQAECSSELYTEASGYISSLEY
PRSYPPDLRCNYSIRVERG
Download sequence
Identical sequences ENSMMUP00000008528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]