SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008560 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008560
Domain Number 1 Region: 18-65
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.0000373
Family DNA-binding domain from NDT80 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008560   Gene: ENSMMUG00000006501   Transcript: ENSMMUT00000009111
Sequence length 184
Comment pep:novel chromosome:MMUL_1:11:66862864:66879144:1 gene:ENSMMUG00000006501 transcript:ENSMMUT00000009111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSTKCVCETTANNMRKKGKPNPDQRYFMLVVGLYAANQDQFYLLSAHVSERIIVRASNPG
QFENDSDALWQRGQVPESVVCHGRVGINTDAPDEALVVCGNMKVMGTIMHPSDSRAKQNI
QEVDTNEQLKRIAQMRIVEYDYKPEFASAMGINTAHQTGMIAQEVQEILPRAVREVGDVT
CENG
Download sequence
Identical sequences ENSMMUP00000008560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]