SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008575 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008575
Domain Number 1 Region: 529-744
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-104
Family Thrombospondin C-terminal domain 0.000000089
Further Details:      
 
Domain Number 2 Region: 406-527
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.26e-35
Family TSP type-3 repeat 0.00000345
Further Details:      
 
Domain Number 3 Region: 337-408
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000536
Family TSP type-3 repeat 0.00019
Further Details:      
 
Domain Number 4 Region: 267-349
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000017
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 28-66
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000615
Family Assembly domain of cartilage oligomeric matrix protein 0.0008
Further Details:      
 
Domain Number 6 Region: 173-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000033
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 91-230
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000127
Family Growth factor receptor domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008575
Domain Number - Region: 228-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-like domain of nidogen-1 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008575   Gene: ENSMMUG00000006511   Transcript: ENSMMUT00000009128
Sequence length 757
Comment pep:known_by_projection chromosome:MMUL_1:19:18406117:18415230:-1 gene:ENSMMUG00000006511 transcript:ENSMMUT00000009128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPDTACVLLLTLAALGASGQSQIPSGSDLGPQMLRELQETNAALQDVRELLRQQVRGPE
VERRTGMRRDRGGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHEGVGLAFAKANKQVCTD
INECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQESGCQRRAQRFCPDGSPSECHEH
ADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQ
EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRTQKNDDQK
DTDQDGRGDACDDDIDGDRIRNQADNCPRIPNSDQKDSDGDGIGDACDNCPQKSNPDQGD
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGQGDACDNDDDNDGVPDS
RDNCRLVPNPGQEDADRDGVGDVCQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLD
PEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFI
FGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDT
DSQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG
RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRRA
Download sequence
Identical sequences 9544.ENSMMUP00000008575 ENSMMUP00000008575 ENSMMUP00000008575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]