SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008591 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008591
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.57e-22
Family Ribosomal protein S18 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008591   Gene: ENSMMUG00000006525   Transcript: ENSMMUT00000009144
Sequence length 258
Comment pep:known chromosome:MMUL_1:4:30196610:30204328:1 gene:ENSMMUG00000006525 transcript:ENSMMUT00000009144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVLNTLLRRLPMLSLFRGAHRVQVPLQTLCTKPPSEEDSLSPVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRGNKVAGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFHSLYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDRDFSIS
HGAVSATPPAPTLISGDPWYPWYNWKQPPERELSRLRRLYQGHLREESGPPPESMPKMPP
TAPVEASFTGQTDPQSAL
Download sequence
Identical sequences ENSMMUP00000008591 ENSMMUP00000008591 9544.ENSMMUP00000008591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]