SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008688 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008688
Domain Number 1 Region: 247-322
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.57e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000294
Further Details:      
 
Domain Number 2 Region: 95-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.6e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 8-83
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.7e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008688   Gene: ENSMMUG00000006608   Transcript: ENSMMUT00000009247
Sequence length 331
Comment pep:known chromosome:MMUL_1:11:50530370:50555555:1 gene:ENSMMUG00000006608 transcript:ENSMMUT00000009247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIIT
LAGPTNAIFKAFAMIIDKLEEIIXSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLESPPKGVTIPYRP
KPSSSPVIFAGGQAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEV
KGYWAGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQ
VTITGSAASISLAQYLINVRLSSETGGMGSS
Download sequence
Identical sequences ENSMMUP00000008688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]