SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008738 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008738
Domain Number 1 Region: 25-133
Classification Level Classification E-value
Superfamily PWI domain 3.01e-44
Family PWI domain 0.000000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008738   Gene: ENSMMUG00000006645   Transcript: ENSMMUT00000009300
Sequence length 904
Comment pep:known_by_projection chromosome:MMUL_1:1:27282915:27313026:1 gene:ENSMMUG00000006645 transcript:ENSMMUT00000009300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL
GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP
SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSP
SPRRRSSPVRRERKRSHSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATS
TSDILKVPKPEPIPEPKEPSPEKNSKKEKEKEKARPRSRSRSKSRSRTRSRSPSHTRPRR
RHRSRSRSYSPRRRPSPRRRPSPRRRTPPKRMPPPPRHRRSRSPVRRRRRSSASLSGSSS
SSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPPKTRHSPTPQQS
NRTRKSRVSVSPGRTSGKVTKHKGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQ
QRRQYRRQNQQSSSDSGSSSSSEDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKET
SPRGRRRRSPSPPPTRRRRSPSPAPPPRRRRTPTPPPRRRTPSPPPRRRSPSPRRYSPPI
QRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRSSPVTKRRSPSLSSKH
RKGSSPSRSTREARSPQPNKRHSPSPRPRAPQTSSSPPPVRRGASSSPQRRQSPSPSTRP
IRRVSRTPEPKKIKKVASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNW
SPAVPVKKAKSPTPSPSPPRNSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAVAAA
AAAAVTPAAVAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQV
SPQS
Download sequence
Identical sequences F7H421
XP_001106234.2.72884 ENSMMUP00000008738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]