SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008750 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008750
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.000000000000547
Family DNA-binding domain from NDT80 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008750   Gene: ENSMMUG00000006655   Transcript: ENSMMUT00000009313
Sequence length 488
Comment pep:known_by_projection chromosome:MMUL_1:14:12303541:12309873:-1 gene:ENSMMUG00000006655 transcript:ENSMMUT00000009313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGMLGEPKFVKTPEGLKPLDCFYLKL
HGLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLHFSETTANNMRKKGKP
NPDQRYFMLVVALQAHAQNQNYTLAAQISERIIVRASNPGQFESDSDVLWQRAQVPDTVF
HHGRVGINTDRPDEALVVHGNVKVMGSLMHPSDLRAKEHVQEVDTTEQLKRISRMRLVHY
RYKPEFAASAGIEATAPETGVIAQEVKEILPEAVKDTGDMVFANGKTIENFLVVNKVCGH
PRMVTSTLKYVISCEDDFCHVLSLGAKEASQVKELCKLTDNLETRIDELERWSHKLAKLR
RLDSLKSTGSSGAFSHAGSQFSRAGSVPHKKRPPKVASKVRSSSVVPDQACISQRFLQGT
IIALVVVMAFRHNLGAQLQEQGPQPCPGERALAGGSSSNSHPFPWLQRGVHVHTVRAEPA
HRGGPGRH
Download sequence
Identical sequences ENSMMUP00000008750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]