SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009005 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009005
Domain Number 1 Region: 22-146
Classification Level Classification E-value
Superfamily Lysozyme-like 4.5e-45
Family C-type lysozyme 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009005   Gene: ENSMMUG00000006850   Transcript: ENSMMUT00000009582
Sequence length 148
Comment pep:known chromosome:MMUL_1:16:31215047:31219931:-1 gene:ENSMMUG00000006850 transcript:ENSMMUT00000009582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKVLFIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS
KINENADGSFDYGLFQINGHYWCNDYRSHSENLCQVDCQDLLNPNLLAGIHCAKRIVSGA
RGMNNWVEWRLHCSGRPLSYWLTGCRLG
Download sequence
Identical sequences A0A2K6CTY7 F7FCQ1 G7PU48
ENSMMUP00000009005 9544.ENSMMUP00000009005 ENSMMUP00000009005 NP_001181584.1.72884 XP_011745615.1.29376 XP_014974522.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]