SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009019 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009019
Domain Number 1 Region: 31-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000746
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009019   Gene: ENSMMUG00000006863   Transcript: ENSMMUT00000009598
Sequence length 257
Comment pep:known chromosome:MMUL_1:18:29723438:29757074:-1 gene:ENSMMUG00000006863 transcript:ENSMMUT00000009598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEASPPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCV
MPEDVKNFYLMTNGFHMTWSVKLDASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSG
KPALAEDTEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFS
MYKPITYNTSLLTEETDSFVNKLDPSKVFKSKNKIVIPKKKGPVQPAGGQKGPSGPSGPS
TSSTSKSSSGSGNPIRK
Download sequence
Identical sequences A0A2K5W8R6 A0A2K6DJ94
XP_014977215.1.72884 ENSMMUP00000009019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]