SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009055 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009055
Domain Number 1 Region: 143-386
Classification Level Classification E-value
Superfamily vWA-like 4e-77
Family Integrin A (or I) domain 0.000000549
Further Details:      
 
Domain Number 2 Region: 387-473
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-20
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 3 Region: 44-102
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000011
Family Plexin repeat 0.00061
Further Details:      
 
Domain Number 4 Region: 591-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family Integrin beta EGF-like domains 0.0056
Further Details:      
 
Domain Number 5 Region: 547-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009055
Domain Number - Region: 510-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00181
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009055   Gene: ENSMMUG00000006898   Transcript: ENSMMUT00000009639
Sequence length 769
Comment pep:known chromosome:MMUL_1:3:105756489:105835961:-1 gene:ENSMMUG00000006898 transcript:ENSMMUT00000009639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVLSLVLGLGQGEDNICASSNAASCARCLA
LGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVHVENQVQGVYFNITAICPDGSRKPGMEGCR
NVTSNHEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV
CSGRGTCVCGRCECTDPRSIGRFCEHCPTCHTACKENWNCVQCLHPHNLSQAILDQCKTS
CALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSS
DYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
Download sequence
Identical sequences F7F3K9 G7P0S0
ENSMMUP00000009055 NP_001252922.1.72884 XP_005550076.1.63531 ENSMMUP00000009055 9544.ENSMMUP00000009055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]