SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009084 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009084
Domain Number 1 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family Laminin-type module 0.081
Further Details:      
 
Domain Number 2 Region: 353-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 409-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000152
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 4 Region: 456-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000565
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009084
Domain Number - Region: 24-65,104-166
Classification Level Classification E-value
Superfamily Sialidases 0.000226
Family Sialidases (neuraminidases) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009084   Gene: ENSMMUG00000006923   Transcript: ENSMMUT00000009670
Sequence length 530
Comment pep:known chromosome:MMUL_1:15:6425132:6509123:-1 gene:ENSMMUG00000006923 transcript:ENSMMUT00000009670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLE
ANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMRE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAGSFGNCECYGHSN
RCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDR
CNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRG
YTGVRCEQPRCDPADDDGGLDCDHAPGAAPRPATLLGCLLLLGLAARLSR
Download sequence
Identical sequences A0A2K5X0R8 A0A2K6C3G7 F7EV15
NP_001252693.1.72884 XP_005580640.1.63531 XP_011710024.1.29376 XP_014971980.1.72884 XP_014971981.1.72884 XP_014971982.1.72884 XP_014971984.1.72884 XP_014971985.1.72884 XP_015291786.1.63531 XP_015291787.1.63531 XP_015291788.1.63531 XP_015291789.1.63531 XP_015291790.1.63531 ENSMMUP00000009084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]