SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009086 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009086
Domain Number 1 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.081
Further Details:      
 
Domain Number 2 Region: 345-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 401-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000152
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 4 Region: 448-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000468
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009086
Domain Number - Region: 24-43,93-179
Classification Level Classification E-value
Superfamily Sialidases 0.000137
Family Endo-alpha-sialidase 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009086   Gene: ENSMMUG00000006923   Transcript: ENSMMUT00000009672
Sequence length 522
Comment pep:known chromosome:MMUL_1:15:6425132:6504290:-1 gene:ENSMMUG00000006923 transcript:ENSMMUT00000009672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLE
ANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMRE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNAYCECYGHSNRCSYIDFL
NVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDRCNETGFCE
CREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRGYTGVRCEQ
PRCDPADDDGGLDCDHAPGAAPRPATLLGCLLLLGLAARLSR
Download sequence
Identical sequences ENSMMUP00000009086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]