SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009088 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009088
Domain Number 1 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family Laminin-type module 0.081
Further Details:      
 
Domain Number 2 Region: 354-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000299
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 410-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000152
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 4 Region: 457-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000565
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009088
Domain Number - Region: 24-65,104-166
Classification Level Classification E-value
Superfamily Sialidases 0.000226
Family Sialidases (neuraminidases) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009088   Gene: ENSMMUG00000006923   Transcript: ENSMMUT00000009674
Sequence length 531
Comment pep:known chromosome:MMUL_1:15:6425141:6509123:-1 gene:ENSMMUG00000006923 transcript:ENSMMUT00000009674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLE
ANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMRE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACTGQFSFRNHCECYGHS
NRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHD
RCNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPR
GYTGVRCEQPRCDPADDDGGLDCDHAPGAAPRPATLLGCLLLLGLAARLSR
Download sequence
Identical sequences ENSMMUP00000009088 ENSMMUP00000009088 9544.ENSMMUP00000009088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]