SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009107 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009107
Domain Number 1 Region: 62-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000146
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 2 Region: 103-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000294
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 34-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000455
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009107   Gene: ENSMMUG00000006935   Transcript: ENSMMUT00000009695
Sequence length 641
Comment pep:novel chromosome:MMUL_1:20:19328933:19349164:-1 gene:ENSMMUG00000006935 transcript:ENSMMUT00000009695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQPSLTWVLLLAVASWLITTAATDSSEARWCSECHSNATCKEDEAATTCTCKEGFAGDG
LTCVDVDECAIPGAHNCSANSRCVNTPGSFSCVCHEGFRLSPGLGCTDVDECAEPGLSHC
HALATCVNVVGNYSCVCPAGYWGDGWHCECSPGSCGPGLDCVPEGDTLVCADPCQAHRIL
DEYWRSTEYGEGYYCDTDLRGWYRFVGQGGVRLAETCVPVLRCNTAAPMWLNGSHPSSDQ
GIVSRKACAHWSGHCCLWDASIQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEEC
SLDEDCKSNNGRWHCQCKQDFNISDISLLEHRLECGANDMKVSLGKCQLKSLGFEKVFMY
LSDSRCSGFNDRDNRDWVSVVTPTRDGPCGTVLTRNETHATYSNTLYLADEIIIRDRNIK
INFACSYPLDMKVSLKTSLQPVVSVLNIRVGGTGMFTVRMALFQSPSYTQPYEGSSVTLS
TEAFLYVGTMLDGGDLSRFALLMTNCYATPSGNATDPLKYFIIQDRCPQTKDSTVQVVEN
GESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCSGTRFRSESVIDQSRVLN
LGPITRKGVQATVSRAAFSSLGLLKVWLPLLLSATLTLTFQ
Download sequence
Identical sequences G7NPY2
ENSMMUP00000009107 9544.ENSMMUP00000009107 XP_014981228.1.72884 XP_014981229.1.72884 ENSMMUP00000009107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]