SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009228 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009228
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.000000785
Family DNA polymerase processivity factor 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009228   Gene: ENSMMUG00000007034   Transcript: ENSMMUT00000009825
Sequence length 280
Comment pep:known chromosome:MMUL_1:3:78492075:78506749:1 gene:ENSMMUG00000007034 transcript:ENSMMUT00000009825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQ
ENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELL
SMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHL
VIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHQDRNVEHMAEVHIDIRKLLQF
LAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences G7MLB7 G7P1S9
ENSMMUP00000009228 ENSMMUP00000009228 XP_001088000.1.72884 XP_005549685.1.63531 9544.ENSMMUP00000009228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]