SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009265 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009265
Domain Number 1 Region: 64-185
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000053
Family Thioltransferase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009265   Gene: ENSMMUG00000007068   Transcript: ENSMMUT00000009870
Sequence length 296
Comment pep:known chromosome:MMUL_1:8:15410644:15587322:1 gene:ENSMMUG00000007068 transcript:ENSMMUT00000009870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWS
SRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSS
AFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAK
WIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLTFQQYTLSR
Download sequence
Identical sequences ENSMMUP00000009265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]