SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009425 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009425
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.61e-45
Family Canonical RBD 0.0000701
Further Details:      
 
Domain Number 2 Region: 179-307
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.94e-33
Family Canonical RBD 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009425   Gene: ENSMMUG00000007193   Transcript: ENSMMUT00000010041
Sequence length 309
Comment pep:known_by_projection chromosome:MMUL_1:5:126593706:126594773:-1 gene:ENSMMUG00000007193 transcript:ENSMMUT00000010041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLYVGDLHADVTEDLLFRKFSAAGPVLSIRICRDQVTRRSLGYAYVNFLQLTDAQKALDT
MNFDIIKGKSIRLMWSQRDAYLRRSGIGNVFIKNLDKSIDNKTLYEHFSGFGKILSSKVM
SDDQGSKGYAFVHFQNQSAADRAIEEMNGKLLKSCKVFVGRFKNRKDREAELRSKASEFT
NIYIKNFGGDMDDERLKDVFSKYGKTLSVKVMTDSSGKSKGFGFLKRERIRGYQGVKLYV
KNLDDTIDDEKLRNEFSSFGSIIRVKVMQQEGQSKGFGFICFSSLEDATKAMIEMNGCFL
GSKPISIAL
Download sequence
Identical sequences ENSMMUP00000009425 9544.ENSMMUP00000009425 ENSMMUP00000009425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]