SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009457 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009457
Domain Number 1 Region: 1553-1666
Classification Level Classification E-value
Superfamily C-type lectin-like 1.25e-44
Family Noncollagenous (NC1) domain of collagen IV 0.00000273
Further Details:      
 
Domain Number 2 Region: 1447-1552
Classification Level Classification E-value
Superfamily C-type lectin-like 1.46e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009457   Gene: ENSMMUG00000007205   Transcript: ENSMMUT00000010076
Sequence length 1668
Comment pep:known_by_projection chromosome:MMUL_1:X:106883613:107031620:-1 gene:ENSMMUG00000007205 transcript:ENSMMUT00000010076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEKSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPSGPQGFTGSTGLSGLKGERGSP
GLLGPYGPKGDKSLIACLAFLAVEPFRGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYP
GLLGPPGLPGQKGSKGDPVLAPGSFKGMKAFIPLFESIRGPQGAPGSSGAVGPAGPPGLQ
LIPPGDQGQPLFLEGAIGVIYQIRDSLFGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKG
EPGPKGFPGISGPPGFPANRKTSSHGYYPCAICPDLIQRPDPLMLSYFQLSGNYGKKGTL
GFPGLNGFQGIEGEKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRG
PSGVAGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPGP
EFEAETLHNKEPGFPGLRGEQGPKGNPGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPR
GLIGLPGLKGARGDRGSGGAQGPAGAPGLVGSPGPSGPKGKKGEPILSTISGMPGDRGDS
GSQGFPGVIGKPGNDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGIGL
PGLPGPRGLPGDKGKDGLPGQQGPPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGL
PGTPGQPGSSGNKGKPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGTIGSPGL
PGSKGATGDIFGAENGAPGEQGLQGLTGDKGLLGDSGLPGLKGVYGKPGLLGPKGERGSP
GTPGPVGQPGTPGSSGPYGIKGKSGLPGAPGFPGTSGHPGKKGTRGEKGPPGSIVKKGLP
GLKGLPGNPGLIGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLK
GIPGSTGKMGPSGHAGTPGEKGDRGNPGPVGIPGPRRPMSNLWLKGDKGSQGSAGSDGFP
GPRGDKGEAGQPGPPGLPGAPGLPGTIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGM
PGESGSQGIRGSSGLPGTSGLPGLKGDNGQTLEISGSPGPKGQPGESGFKGTKGRDGPIG
NIGFPGNKGEDGKVGVSGDVGLHGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGPPGLIG
PKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPG
LRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPPGPPGPTG
PSSNQGNTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPG
DPGFPGMKGKAGPRGSSGPQGAPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPV
GLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQS
ARVGYTLVKHSQSEQVPLCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMP
FIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQ
DITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTC
HYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKSL
Download sequence
Identical sequences ENSMMUP00000009457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]