SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Macaca mulatta 76_1 > ENSMMUP00000009479

Domain assignment for ENSMMUP00000009479 from Macaca mulatta 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMMUP00000009479
Domain Number 1	Region: 164-221
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2.68e-21
Family	Classic zinc finger, C2H2	0.006
Further Details:

Domain Number 2	Region: 220-277
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	3.29e-20
Family	Classic zinc finger, C2H2	0.0056
Further Details:

Domain Number 3	Region: 126-178
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.43e-18
Family	Classic zinc finger, C2H2	0.0034
Further Details:

Domain Number 4	Region: 266-318
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2.46e-18
Family	Classic zinc finger, C2H2	0.01
Further Details:

Domain Number 5	Region: 63-112
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00000000856
Family	Classic zinc finger, C2H2	0.0087
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMMUP00000009479 Gene: ENSMMUG00000007227 Transcript: ENSMMUT00000010098
Sequence length	324
Comment	pep:known_by_projection chromosome:MMUL_1:4:27996260:28009753:1 gene:ENSMMUG00000007227 transcript:ENSMMUT00000010098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSPLRGVQEQQVRPECEVTKPEKEKGEETRIENGKLVVVTDSCGRVESSGKISEPMEAHN EGSNLERQQAKPKEETEYKCSECGQGFLQHSDLIEHASMHTGKKLCESDVCQSSSLTGHK VLSREKGHQCHECGKAFQRSSHLVRHQKIHLGEKPYQCNECGKVFSQNAGLLEHLRIHTG EKPYLCIHCGKNFRRSSHLNRHQRIHSQEEPCECKECGKTFSQALLLTHHQRIHSHSKNH QCNECGKAFSLTSDLIRHHRIHTGEKPFKCNICQKAFRLNSHLAQHVRIHNEEKPYQCSE CGEAFRQRSGLFQHQRYHHKDKLA
Download sequence
Identical sequences	9544.ENSMMUP00000009480 ENSMMUP00000009479 ENSMMUP00000009479 ENSMMUP00000009480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]