SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009576 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009576
Domain Number 1 Region: 536-857
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.4e-109
Family PDEase 0.0000000000121
Further Details:      
 
Domain Number 2 Region: 147-341
Classification Level Classification E-value
Superfamily GAF domain-like 2.18e-44
Family GAF domain 0.0000786
Further Details:      
 
Domain Number 3 Region: 327-531
Classification Level Classification E-value
Superfamily GAF domain-like 5.67e-38
Family GAF domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009576   Gene: ENSMMUG00000007305   Transcript: ENSMMUT00000010207
Sequence length 875
Comment pep:known chromosome:MMUL_1:5:111923507:112049597:-1 gene:ENSMMUG00000007305 transcript:ENSMMUT00000010207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAGLSFGRQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAE
RVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEG
TVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLI
SADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAALGEPL
NIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDE
KDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIIS
FMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDMLTREHDTNKINYMYAQYVKNTME
PLNIPDVSKDKRFPWTTENTGNVSQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGK
VKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETREL
QSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWIL
SVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGV
NNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAI
LATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAE
LVASEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCF
PLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN
Download sequence
Identical sequences XP_001099652.1.72884 ENSMMUP00000009576 9544.ENSMMUP00000009576 ENSMMUP00000009576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]