SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009628 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009628
Domain Number 1 Region: 62-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000215
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009628   Gene: ENSMMUG00000007340   Transcript: ENSMMUT00000010261
Sequence length 207
Comment pep:known chromosome:MMUL_1:14:70036097:70039762:1 gene:ENSMMUG00000007340 transcript:ENSMMUT00000010261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHNWTPDLSFLWVLLCAHIITLLVRATPVSQTTTAATASSRSTKDPCPSQPPVFPAAKQ
CPALEVTWPEVEMPLNGTLTLSCTACSRFPNFSMLYWLGNGSFIEHLPGQLWEGSTSREH
GSTGTRLYKALVLEQLTPALHSTNFSCVLMDPAQVVQRHVILAQLWAGLRTTLPPTQEAL
PSSHSTGPQQPTAAGLRLSTGPAAARP
Download sequence
Identical sequences B2D0A1
NP_001116825.1.72884 XP_014970507.1.72884 XP_014970508.1.72884 XP_014970509.1.72884 9544.ENSMMUP00000009628 ENSMMUP00000009623 ENSMMUP00000009623 ENSMMUP00000009628 ENSMMUP00000036853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]