SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009648 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009648
Domain Number 1 Region: 6-236
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.34e-65
Family Proteasome subunits 0.00000000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009648   Gene: ENSMMUG00000007358   Transcript: ENSMMUT00000010282
Sequence length 277
Comment pep:known chromosome:MMUL_1:15:11337930:11400617:1 gene:ENSMMUG00000007358 transcript:ENSMMUT00000010282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPYTVPNKKGT
RLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
Download sequence
Identical sequences A0A2K5YY68 A0A2K6CCZ7 F7E9M5 G7PRG8
ENSPANP00000018897 NP_001252592.1.72884 XP_011709624.1.29376 XP_011844058.1.47321 XP_015291913.1.63531 ENSMMUP00000009648 9544.ENSMMUP00000009648 ENSMMUP00000009648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]