SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009701 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009701
Domain Number 1 Region: 26-294
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.16e-86
Family (Glycosyl)asparaginase 0.00000000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009701   Gene: ENSMMUG00000007393   Transcript: ENSMMUT00000010339
Sequence length 347
Comment pep:known_by_projection chromosome:MMUL_1:5:169546898:169566301:-1 gene:ENSMMUG00000007393 transcript:ENSMMUT00000010339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKSKLPLLLVPLLLCQALVRCSSPLPLVLNTWPFKNATEAAWRALASGGSALDAVESG
CAMCETEQCDGSVGFGGSPDELGETTLDAMIMEGTTMDVGAVGDLRRIKNAIGVARKVLE
HTTHTLLVGESATKFAESMGFVNEDLSTSASQALHSDWLARNCQPNYWRNVVPDPSKYCG
PYKPLGILKQDIPIHKETEDNRGHDTIGMVVIHKTGRIAAGTSTNGIKFKIHGRVGDSPV
PGAGAYADDTAGAAAATGDGDILMRFLPRYHFLQYLYCSEEETLPASSQISNICIGYKYV
HPVVNQTSFSFLAPGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI
Download sequence
Identical sequences ENSMMUP00000009701 ENSMMUP00000009701 9544.ENSMMUP00000009701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]