SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009797 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009797
Domain Number 1 Region: 49-276,307-337
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.47e-41
Family FAD-linked reductases, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009797   Gene: ENSMMUG00000007468   Transcript: ENSMMUT00000010439
Sequence length 463
Comment pep:known chromosome:MMUL_1:7:113307755:113375957:-1 gene:ENSMMUG00000007468 transcript:ENSMMUT00000010439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPALRYLVGACGRARGGFAGGFLGACGSASGRPRPLCGGGRSASTSSFDIVIIGGGIVG
LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALL
YEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYERGLQNGIQGLRLIQQEDIKKKEPYCR
GLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKDIEMAKESPSRSIDGMQYPI
VIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNI
YPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKL
ASQNFSYGVTEMYKACFLGATVKYLQKFIPEITVSDILRGPAGVRAQALDRDGNLVEDFV
FDAGVGNIGNRVLHVRNAPSPAATSSLAISGMIADEVQQRFEL
Download sequence
Identical sequences G7MXQ7
ENSMMUP00000009797 ENSMMUP00000009797 9544.ENSMMUP00000009797 XP_001099959.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]