SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009966 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009966
Domain Number 1 Region: 1195-1525
Classification Level Classification E-value
Superfamily NHL repeat 2.14e-23
Family NHL repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 1424-1471,1498-1662
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000124
Family SGL-like 0.038
Further Details:      
 
Domain Number 3 Region: 633-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number 4 Region: 891-963
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000863
Family Carboxypeptidase regulatory domain 0.035
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000009966
Domain Number - Region: 699-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 602-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 731-756
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000495
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 567-594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00164
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 764-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00179
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 537-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.035
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 2093-2191,2283-2343
Classification Level Classification E-value
Superfamily NHL repeat 0.0968
Family NHL repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009966   Gene: ENSMMUG00000007587   Transcript: ENSMMUT00000010622
Sequence length 2727
Comment pep:known chromosome:MMUL_1:X:122634785:123228662:-1 gene:ENSMMUG00000007587 transcript:ENSMMUT00000010622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTDCKPYQPLSKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQ
SRKKKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRRDYQLEMGSDVDTETEGAASPDHA
LRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQGK
YVQSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTST
QDSVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRS
TFSRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGELYA
NGVSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFW
RFQITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDD
TQHSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNG
NGECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRHGWKGPECDVPEEQCID
PTCFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSNHGICVKGECHCSTGWGGVNCETP
LPICQEQCSGHGTFLLDTGVCSCDPKWTGSDCSTELCTMECGSHGVCSRGICQCEEGWVG
PTCEERSCHSHCTEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLD
QNGWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYVSPLCQGSP
DPLDLIQQSQPLFSQHTSRLFFDRIKFLIGKDSTHVIPPEVSFDSRRACVIRGQVVAVDG
TPLVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVILIFDRSPFLPEKRTLWLPWNQF
IVVEKVTMQRVVSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIP
IPSSFVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGRLTQKWFPAAINLV
YTFAWNKTDIYGQKVWGLAEALVSVGYEYETCPDFILWEQRTVVLQGFEMDASNLGGWSL
NKHHILNPQSGIIHKGNGENMFISQQPPVISTIMGNGHQRSVACTNCNGPAHNNKLFAPV
ALASGPDGSVYVGDFNFVRRIFPSGNSVSILELSTSPAHKYYLAMDPVSESLYLSDTNTR
KVYKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITVDRHGF
IYFVDGTMIRKIDENAVIATVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNS
LYVLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGL
LFIAETDERKVNRIQQVTTNGEISIIAGAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPS
SLAVSPDGTLYVADLGNVRIRTISRNQAHLNDMNLYEIASPADQELYQFTVNGTHLHTLN
LITRDYVYNFTYNSEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVL
KRVSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDL
EKLTKVELDTSNRENVLMSTNLTATSTIYILKQENTQSTYRVSPDGSLRVTFASGMEINL
SSEPHILAGAVNPTLGKCNISLPGEHSANLIEWRQRKEQNKGNVSAFERRLRAHNRNLLS
IDFDHITRTGKIYDDHRKFTLRILYDQTGRPILWSPVSRYNEVNITYSPSGLVTFIQRGT
WNEKMEYDQSGKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQPDCLLSVTMPS
MVRHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTQHLGTGRRVLYKYTKQARL
SEVLYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNAR
FDYSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKH
TKIFSANGQVIEVQYEILKAIAYWMTIQYDNVGRMVICDIRVGVDANITRYFYEYDADGQ
LQTVSVNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMDEDGFL
RQRGNDIFEYNSNGLLQKAYNKASGWTVQYYYDGLGRRVASKSSLGQHLQFFYADLTNPI
RVTHLYNHTSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSSRGQVIKEIL
YTPYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDVVAGRWTTPNHHIWKQLNL
LPKPFNLYSFENNYPVGKIQDVAKYTTDIRSWLELFGFQLHNVLPGFPKPELENLELTYE
LLRLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYNDGRCLEGGKQPRFAAV
PSVFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTHYFIKL
GSLEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRYGTT
VEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFV
LSVEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences 9544.ENSMMUP00000009966 ENSMMUP00000009966 ENSMMUP00000009966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]