SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009996 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009996
Domain Number 1 Region: 251-511
Classification Level Classification E-value
Superfamily YWTD domain 1.16e-56
Family YWTD domain 0.0000000173
Further Details:      
 
Domain Number 2 Region: 42-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 3 Region: 81-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 4 Region: 116-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 5 Region: 167-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000181
Family EGF-type module 0.0023
Further Details:      
 
Domain Number 6 Region: 203-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 7 Region: 522-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009996   Gene: ENSMMUG00000007612   Transcript: ENSMMUT00000010653
Sequence length 789
Comment pep:known_by_projection chromosome:MMUL_1:1:56126577:56206389:-1 gene:ENSMMUG00000007612 transcript:ENSMMUT00000010653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPERGALRPLALLLLLLLLQLQHLAAAAADPLLGGQGPAKECEKDQFQCRNERCIPSV
WRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCT
KQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCVTWLNECLHNNGGCSHICTD
LKIGFECTCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKN
CKAAAGKSPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRK
IYSAYMDKASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRCT
LFSRNLSEPRAIAVDPLQGFMYWSDWGNQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDL
LSQRLYWVDSKLHQLSSIDFSGGNRKMLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFS
ANRLNGLEISILAENLNNPHDIVIFHELKQPRAADACKLSVQPNGGCEYLCLPAPQISSH
SPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLPSTTRTGPASTGAPGTTVHRSTDQNHS
TETPNLAAAVPSSVSVPRAPSISLSTLSPATSNHSQHYGNEDSKMGSTVTAAVIGIIVPI
VVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDELHIGRTAQIGHVYPAAI
SSFDRPLWAEPCLGETRELEDPAPALKELFVLPGEPRSQLHQLPRNPLSELPVVKSKRVA
LSLEDDGLP
Download sequence
Identical sequences F6SDD2
ENSMMUP00000009996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]