SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010030 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010030
Domain Number 1 Region: 279-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000422
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010030
Domain Number - Region: 834-855,903-930
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000112
Family Classic zinc finger, C2H2 0.061
Further Details:      
 
Domain Number - Region: 456-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0117
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010030   Gene: ENSMMUG00000007635   Transcript: ENSMMUT00000010693
Sequence length 1197
Comment pep:known chromosome:MMUL_1:1:93620675:93722365:-1 gene:ENSMMUG00000007635 transcript:ENSMMUT00000010693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKGSVSLTTGQPVDQPTTESCSTLKVAADLQLSTPQKASQHQVLFLLSDVAHAKNPTHS
NKKLPTSASVGCDIQNSVGSNIKSDGTLINQVEVGEDGEDLLVKDDCVNTVTGISSGTDG
FRSENDTNWDPQKEFIQFLMTNEETVDKAPPHSKVGLEKKRKRKMDVSKITRYTEDCFSD
SNCVPNKSKMQEVDFLEQNEELQAVDPQKYALSKVKPESTDEDLESVDAFQHLIYNPDKC
GEESSPVHTSTFLSNTLKKKCEESDSESPATFSTEEPSFYPCTKCNVNFREKKHLHRHMM
YHLDGNSHFRHLNVPRPYACRECGRTFRDRNSLLKHMIIHQERRQKLMEEIRELKELQDE
GRSARLQCPQCVFGTNCPKTFVQHAKTHEKDKRYYCCEECNFMAVTENELECHRGIAHGA
VVKCPLVTSDIAQRKTQKKTFMKDSVVGSSKKSATYVCKMCPFTTSAKSVLKKHMEYLHS
SSCVDSFGSPLGLDKRKNDILEEPVDSDSTKPLTKQQSTTFPKNSALKQDVKRTFGSTSQ
SSSFSKIHKRPHRVQKARKSIAQSGVNTCNQNSSPHKNVTVKSSIDQKPKYFHQTAKEKS
NAKANSNYLYRHKYENYRMIKKSGESYPVHFKKEEASSLNSLHLFSSSSNSHNSFISDPH
KPDTKRPESFKDHRRVAVKRVVKESKKESSVGGEDLDSYPDFLHKMTVVVLQKLNSAEKK
DSYETEDESSWDNVELGDYTTQATEDETYSDINQEHVNLFPLFKSKVEGQEPGENATLSY
DQNDGFYFEYYEDAGSNNFLHEIHDPQHLETADASLSKHSSVFHWTDLSLEKKSCPYCPA
TFETGVGLSNHVRGHLHRAGLSYEARHVVSPEQIATSDKMQHFKRTGTGTPVKRVRKAIE
KSETTSEHTCQLCGGWFDTKIGLSNHVRGHLKRLGKTKWDAHKSPICVLNEMMQNEEKYE
KILKALNSRRIIPRPFVAQKLASNDDFISQNVIPLEAYRNGLKTEALSVSASEEEGLNFL
NEYDETKPELPSGKKNQSLTLIELLKNKRMGEERNSAISPQKIHNQTARKRFVQKCVLPL
NEDSPLMYQPQKMDLTMHSALDCKQKKSRSRSGSKKKMLTLPHGADEVYILRCRFCGLVF
RGPLSVQEDWIKHLQRHIVNANLPRTGAGMVEVTSLLKKPASITETSFSLLMAEAAS
Download sequence
Identical sequences ENSMMUP00000010030 ENSMMUP00000039768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]