SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010068 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010068
Domain Number 1 Region: 308-467
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.27e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000184
Further Details:      
 
Domain Number 2 Region: 146-306
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000393
Further Details:      
 
Domain Number 3 Region: 109-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000979
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 65-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000166
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 23-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000491
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010068   Gene: ENSMMUG00000007661   Transcript: ENSMMUT00000010732
Sequence length 470
Comment pep:known chromosome:MMUL_1:6:80140119:80591909:-1 gene:ENSMMUG00000007661 transcript:ENSMMUT00000010732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVAVWLLVGVSLCVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCS
SVVEVGPCIPNPCHNGGTCEISEAYRGDTFIGYVCKCPQGFNGIHCQHNINECEVEPCKN
GGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWY
PYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAY
SNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRME
LLGCELSGCSEPLGMKSGHIQDYQITASSVFRTLNMDMFTWEPRKARLDKQGKVNAWTSG
HNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKD
KVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Download sequence
Identical sequences A0A2I3MWI8 A0A2K5IID0 A0A2K5WYV1 A0A2K5YLV2 A0A2K6DVN7 A0A2K6LSF0 A0A2K6RTB5
ENSMMUP00000010068 XP_005557385.1.63531 XP_007975675.1.81039 XP_010374519.1.97406 XP_011799619.1.43180 XP_011851846.1.47321 XP_017748928.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]