SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010078 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010078
Domain Number 1 Region: 459-588
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 2 Region: 237-321
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-18
Family Cadherin 0.00061
Further Details:      
 
Domain Number 3 Region: 32-155
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-16
Family Cadherin 0.002
Further Details:      
 
Domain Number 4 Region: 141-243
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000257
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 570-670
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000055
Family Cadherin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010078   Gene: ENSMMUG00000007668   Transcript: ENSMMUT00000010742
Sequence length 895
Comment pep:known_by_projection chromosome:MMUL_1:18:23936848:23985292:-1 gene:ENSMMUG00000007668 transcript:ENSMMUT00000010742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGLRRSVRGAACWQLLLTLVIFSLAGEACKKVILNVPSKLEADKIIGRVNLEECFRS
ADLIQSGDPDFRVLSDGSVYTARAVVLSDEKRSFTIRLSDKRKQTQKEVTVLLEHQKKVL
KTRHTRETVLRRAKRRWAPIPCSMQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDQ
EPLNLFYIERDTGNLFCTQPVDREEYDVFDLIAYASTADGYSADLPLPLPIRVEDENDNH
PVFTEAIYNFEVSESSRLGTTVGVVCATDRDEPDTMHTRLKYSILQQTPRSPGLFSVHPS
TGVITTVSHYLDREDMAIFSVVNLLPDCPPERWCMLTCSPEIFDIYQSNSKKKVFQVAEH
SFYMKTPLNVFYIFKLTSPSVLTKCEHRIYATLVRMTNVHLPFEVPNVFYTDNDMDFILK
PLNYEENHQVNLEIGVNNEAPFTRDIPRVTALNRALVTVHVRDLDEGPECTPAAQYVRIK
ENLAVGSKINGYKAYDPETRNGNGLRYKKLHDPKGWITIDEISGSIITSKILDREVETPK
NELYNITVLAIDKDNRSCTGTLAVDIEDINDNPPEILQEYVVICKPKMGYTDILAVDPDE
PVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAAT
KLLRVNLCECTHPAQCRVTSRSAGVVLGKWAILAILLGIALLFSVLLTLVCGVLGATKGK
RFPEDLAQQNLIISNTEAPGDDRVCSANGFMTQTANNSSQGFCGTVGSGMKNGGQETIEM
MKGGHQTLESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKLHRCNRNED
HMPSQDYVLTYNYEGRGSPAGSVGCCSEKQEEDGLDFLNNLEPKFITLAEACTKR
Download sequence
Identical sequences ENSMMUP00000010078 9544.ENSMMUP00000010078 ENSMMUP00000010078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]