SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010115 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010115
Domain Number 1 Region: 115-259
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.25e-27
Family PDI-like 0.0099
Further Details:      
 
Domain Number 2 Region: 35-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000206
Family ERP29 N domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010115   Gene: ENSMMUG00000007696   Transcript: ENSMMUT00000010782
Sequence length 262
Comment pep:known chromosome:MMUL_1:2:43052528:43146243:1 gene:ENSMMUG00000007696 transcript:ENSMMUT00000010782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAGPAWLLLAIWVVLPLWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEAAA
ENHLRLLSIVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHT
EYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAP
WCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLF
QYDNYGSTAEDILEWLKKVWPL
Download sequence
Identical sequences ENSMMUP00000010115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]