SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010186 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010186
Domain Number 1 Region: 159-298
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 8.25e-41
Family Nucleoside diphosphate kinase, NDK 0.00033
Further Details:      
 
Domain Number 2 Region: 12-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.39e-16
Family Thioltransferase 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010186   Gene: ENSMMUG00000007755   Transcript: ENSMMUT00000010859
Sequence length 330
Comment pep:known_by_projection chromosome:MMUL_1:2:149491924:149521214:1 gene:ENSMMUG00000007755 transcript:ENSMMUT00000010859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRKKEIALQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDL
LHFALAEADRLDVLEKYRGKCEPTFLFYAGGELVAVVRGANAPLLQKTILDQLEAEKKVL
AEGRERKVIKDEALSDEDECVSHGKNNGEDEDMVSSDRTCTLAIIKPDAVAHGKTDEIIM
KIQEAGFEILTNEDRTMTEAEMRLFYQHRAGEEAFEKLVHHMCSGPSHLLILTRTEGFED
VVTSWRTVMGPCDPNVARREQPESLRAQYGTEMPFNAVHGSQDREDADRELALLFPSLKF
SDKDTEAPQGGEAEATEGPTEALCFPEDVD
Download sequence
Identical sequences A0A2K6C064 F7BXF1 G7P034
9544.ENSMMUP00000010186 XP_005545940.1.63531 XP_011719859.1.29376 XP_011719860.1.29376 XP_014987573.1.72884 XP_014987574.1.72884 ENSMMUP00000010186 ENSMMUP00000010186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]