SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010188 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010188
Domain Number 1 Region: 1634-1759
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-34
Family Cadherin 0.00089
Further Details:      
 
Domain Number 2 Region: 1090-1212
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-33
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 1840-1964
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-31
Family Cadherin 0.0014
Further Details:      
 
Domain Number 4 Region: 240-361
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 5 Region: 458-571
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-28
Family Cadherin 0.0018
Further Details:      
 
Domain Number 6 Region: 2157-2278
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-27
Family Cadherin 0.0023
Further Details:      
 
Domain Number 7 Region: 1537-1639
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-25
Family Cadherin 0.003
Further Details:      
 
Domain Number 8 Region: 2592-2696
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 9 Region: 1742-1852
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-24
Family Cadherin 0.0018
Further Details:      
 
Domain Number 10 Region: 563-673
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-24
Family Cadherin 0.00071
Further Details:      
 
Domain Number 11 Region: 2473-2592
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-23
Family Cadherin 0.0023
Further Details:      
 
Domain Number 12 Region: 880-990
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-22
Family Cadherin 0.0061
Further Details:      
 
Domain Number 13 Region: 2361-2471
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 14 Region: 2696-2801
Classification Level Classification E-value
Superfamily Cadherin-like 8.38e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 15 Region: 1202-1309
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 16 Region: 676-777
Classification Level Classification E-value
Superfamily Cadherin-like 3e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 17 Region: 133-244
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-18
Family Cadherin 0.0039
Further Details:      
 
Domain Number 18 Region: 353-461
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-17
Family Cadherin 0.0039
Further Details:      
 
Domain Number 19 Region: 2268-2373
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-16
Family Cadherin 0.003
Further Details:      
 
Domain Number 20 Region: 994-1093
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-16
Family Cadherin 0.0022
Further Details:      
 
Domain Number 21 Region: 1945-2084
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-16
Family Cadherin 0.0081
Further Details:      
 
Domain Number 22 Region: 784-883
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-16
Family Cadherin 0.0043
Further Details:      
 
Domain Number 23 Region: 1427-1535
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000134
Family Cadherin 0.00092
Further Details:      
 
Domain Number 24 Region: 2063-2160
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000828
Family Cadherin 0.0017
Further Details:      
 
Domain Number 25 Region: 2798-2868
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000528
Family Cadherin 0.0031
Further Details:      
 
Domain Number 26 Region: 45-132
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000186
Family Cadherin 0.0064
Further Details:      
 
Domain Number 27 Region: 1360-1433
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000542
Family Cadherin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010188   Gene: ENSMMUG00000007754   Transcript: ENSMMUT00000010861
Sequence length 3295
Comment pep:known_by_projection chromosome:MMUL_1:14:65562088:65581698:1 gene:ENSMMUG00000007754 transcript:ENSMMUT00000010861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKEPGIVPSCPGMKSPRPRLLLPLLLLLLGAGVPGAWAQAGSLDLQIDEEQPAGTLIGD
ISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAVTPD
GATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTCYPLEPARDADAGHLGTQGYALS
GDGAGETFRLETRPGPDGAPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQTLLDV
TLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGANGAVTYEINRRQSEGDG
PFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQPSMT
VIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYL
VCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQFYQPEPLP
EVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYELEPQ
PQLTVVATDGGLPPLASSATVNVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTAT
DADSGLFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAVDGG
GLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRVRAHDPDQGSHGRLSYH
ILAGNSPPLFALDEQSGLLTVAWPLARRANSVVQLEIGAQDGGGLQAEPSARVNISIVPG
TPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLDAIS
GLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDTVLL
PPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRHLGPSGGPA
HELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPQFDSPTYRVDLPSGTIPGTQVLQVQ
AQAPDGGPVTYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKAELG
QQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTNVGRVFATDRDSGPNGRLTYS
LQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSTYQLLVQVQDGGSPSHSTTGTVHVAVLD
LNDNSPTFLQASGAAAGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSEL
FSLNPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSTRLAEPPPD
LAERDPAAPVPVVLTVTAAEGLQPGSLLGSVAPPEPAGLGALTYTLVGGADPEGTFALDA
ASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVHVQDENEHAPAFARDPLAL
ALPENPEPSAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRGLDR
ETTPALLLLVEATDRPANASRRRATRVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPA
ALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVQPLDREQRAEHVLIVVASD
HGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENSAPGTSLLTLRATDPDLGANGQ
VTYGGVSSGSFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHATIRVAVED
ENDHAPTFGSTHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVLDLA
SGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAYSVE
VPEDVPAGTLLLQLQAHDPDAGANGRVTYYLGAGTAGAFLLEPSSGELRTAAALDREQCP
SYTFAVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPTLAL
ATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGTRDRVLFIVATDL
GRPARSATGVIIVGLQGEAERGPRFPRTSSEAMIRENAPPGTPIVSPRAVHAGGTNGPIT
YSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLTLQD
ANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLFHVD
PATGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQPWEL
RVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFEQCD
RYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSATDR
DSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGTPGRA
ARATVHVQLQDQNDHAPSFTLPHYRVAVTEDLPPGSTLLTLEATDADGSRTHAAVEYSII
SGNWGRVFQLEPRLAEAGESAGPGPQALGCLVLLEPLDFESLTQYNLTVAAADRGQPPQS
SVVPVTVTVLDVNDNPPVFTRASYRVAVPEDTPVGAELLHVEASDVDPGPHGLVRFTVSS
GDPAGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVNDHG
PAFPLNLLSTSLAENQPPGTLVTTLHAIDGDAGAFGKLRYSLLEAGPGPEGREAFALNSS
TGELRARVAFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHFQVP
EGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSGTAT
TGGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGAVAA
SLGVVVVLALAALVLGLVRARGRKAEAAPGPMSQAAPLASGSLQKVGREPPSPPPSEHLY
HQTLPSYGGPGAGGPYPRGGSLDPSHSSGRGSAEAAEDDEIRMINEFPRVASVASSLAAR
GPDSGIQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGRPATATAFLGGC
GLSPAPTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASVFTEI
ARLKDEARPCPPAPRIDPPPLITAVAHPGAKSVPPKPANTAAARAIFPPAPHRSPISHEG
SLSSAAMSPSFSPSLSPLAARSPVVSPFGVAQGPSASALSTESGLEPPDDTELHI
Download sequence
Identical sequences F7BXD9
ENSMMUP00000010188 ENSMMUP00000010188 XP_014970443.1.72884 9544.ENSMMUP00000010188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]