SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010240 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010240
Domain Number 1 Region: 41-299
Classification Level Classification E-value
Superfamily L domain-like 1.46e-44
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 294-389
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 423-502
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000503
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010240   Gene: ENSMMUG00000007793   Transcript: ENSMMUT00000010915
Sequence length 628
Comment pep:known chromosome:MMUL_1:19:42423053:42431649:1 gene:ENSMMUG00000007793 transcript:ENSMMUT00000010915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAILPLLLCLLPLAPASSPPQSATPSLCPRRCRCQTQSLPLSVLCPGAGLLFVPPSLDRR
AAELRLADNFIASVRRRDLANMTGLLHLSLSRNTIRHVAAGAFADLRALRALHLDGNRLT
SLGEGQLRGLVNLRHLILSNNQLAALAASALDDCAETLEDLDLSYNNLEQLPWEALGRLG
NVNTLGLDHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLARPRGSPAS
ALVLAFGGNPLHCNCELVWLRRLAREDDLEACASPPALGGRYFWAVGEEEFVCEPPVVTH
RSPPLAVPAGRPAALRCRAVGDPEPRVRWVSPQGRLLGNSSRARAFPNGTLELLVTEPGD
GGIFTCIAANAAGEATAAVELTVGPPPPPQLANSTSCDPPRDGDPDALTPPSAASASAKA
ADTGPSTDRGVQVTEHGATAALVQWPDQRPIPGIRMYQIQYNSSADDILVYRMIPADSRS
FLLTDLASGRAYDLCVLAVYEDSATGLTATRPVGCARFSTEPALRPCGAPHAPFLGGTMI
IALGGVIVASVLVFIFVLLMRYKVHGGQPPGKAKTPAPVSSVCSQTNGALGPPPTPAPPA
PEPAALRAHTVVQLDCEPWGPGHEPVGP
Download sequence
Identical sequences A0A2K5LXG7 A0A2K5VI96 A0A2K5ZLT2 A0A2K6DF80 F7CQ48
NP_001252723.1.72884 XP_005588979.1.63531 XP_011763422.1.29376 XP_011840220.1.47321 XP_011840221.1.47321 XP_011899072.1.92194 ENSMMUP00000010240 ENSMMUP00000010240 9544.ENSMMUP00000010240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]