SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010345 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010345
Domain Number 1 Region: 195-314
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-34
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010345   Gene: ENSMMUG00000007876   Transcript: ENSMMUT00000011033
Sequence length 317
Comment pep:known_by_projection chromosome:MMUL_1:16:4362926:4389149:1 gene:ENSMMUG00000007876 transcript:ENSMMUT00000011033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKTSSSCIMENGHQPGAGPGDGSPEVAQTFSAPDPPRPRPVSLSFRLPHQPVTAVTRVS
DRFSGETSAAALSPTAAATLGGLNPSPSEATTPWTPSPGENNSSFTRSVSSSGYGAVTAS
KHSNSPPLVTPPQSPVSPQPPATTQVHRQGERRRELVRSQTLPRTSGAQARKALFEKWEQ
ETAAGKGKGETRARLKRSQSFGVASASSIKQILLEWCRSKTLGYQHVDLQNFSSSWSDGM
AFCALIHSFFPDAFDYNSLSPTQRQKNFELAFTMAENLANCERLIEVEDMMVMGRKPDPM
CVFTYVQSLYNHLRRFE
Download sequence
Identical sequences XP_014973813.1.72884 9544.ENSMMUP00000010345 ENSMMUP00000010345 ENSMMUP00000010345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]