SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010399 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010399
Domain Number 1 Region: 83-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000234
Family LIM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 23-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000369
Family LIM domain 0.0027
Further Details:      
 
Domain Number 3 Region: 145-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000228
Family LIM domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010399   Gene: ENSMMUG00000007922   Transcript: ENSMMUT00000011090
Sequence length 210
Comment pep:known chromosome:MMUL_1:X:134260114:134274810:1 gene:ENSMMUG00000007922 transcript:ENSMMUT00000011090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHRHSGPSSYKVGTMAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECR
KPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGC
FKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKGLVKAPVWWPMKDNPGTTTASTAKNAP
Download sequence
Identical sequences A0A2I2YH72 A0A2I3H3V6 A0A2I3N386 A0A2I3T639 A0A2J8WX69 A0A2K5W494 A0A2K6DEK7 A0A2K6L8B8 A0A2K6QGP3 Q5JXI2
XP_004064974.2.27298 XP_004092584.2.23891 XP_007991001.1.81039 XP_011529618.1.92137 XP_011739229.1.29376 XP_011804168.1.43180 XP_011849794.1.47321 XP_014983772.1.72884 XP_016799743.1.37143 ENSP00000359710 ENSMMUP00000010399 ENSP00000359710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]