SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010494 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000010494
Domain Number - Region: 719-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00272
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 592-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00356
Family Laminin-type module 0.092
Further Details:      
 
Domain Number - Region: 672-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00387
Family EGF-type module 0.085
Further Details:      
 
Domain Number - Region: 287-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family Laminin-type module 0.01
Further Details:      
 
Domain Number - Region: 114-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0156
Family Laminin-type module 0.066
Further Details:      
 
Domain Number - Region: 371-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0202
Family Laminin-type module 0.05
Further Details:      
 
Domain Number - Region: 500-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0227
Family Laminin-type module 0.029
Further Details:      
 
Domain Number - Region: 67-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0263
Family Laminin-type module 0.061
Further Details:      
 
Domain Number - Region: 200-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0347
Family EGF-type module 0.072
Further Details:      
 
Domain Number - Region: 549-594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Laminin-type module 0.043
Further Details:      
 
Domain Number - Region: 158-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0764
Family Laminin-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010494   Gene: ENSMMUG00000008007   Transcript: ENSMMUT00000011194
Sequence length 967
Comment pep:known chromosome:MMUL_1:7:44401282:44646311:-1 gene:ENSMMUG00000008007 transcript:ENSMMUT00000011194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTPSIRSITHDAQTSSTGSSAPGTALCTEECVHGRCVSPDTCHCEPGWGGPDCSSGCDS
DHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGA
SCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGICHHITGECACPPGWTG
AVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFQCS
QRCDCYNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPV
TGACACQPGWSGRHCNESCPAGYYGDGCQQTCTCQNGADCHSITGGCTCAPGFMGEVCAV
SCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTC
ANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLA
GWTGIRCDSTCPSGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICDPGFYG
HSCAQPCPLCVHSSGPCHHVSGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTC
SPIDGSCQCFPGWIGKDCSQVAPEFGWERGGATACLNRSGSRCTPYPHPAATLITGNPVS
LGCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCE
CMNNSTCDHVTGTCYCSPGFKGIRCDQAALMMEELNPYTKISPALGAERHSVGAVTGIML
LLFLIVVLLGLFAWHRRRQKEKGRDLAPRVSYTPAMRMTSTDYSLSGACGMDRRQNTYIM
DKGFKDYMKESVCSSSTCSLNSSENPYATIKDPPILTCKLPESSYVEMKSPVHMGSPYTD
VPSLSTSNKNIYEVEPTVSVVQEGRGHNSSYIQNPYDLPRNSHIPGHYDLLPVRQSPANG
PSQDKQS
Download sequence
Identical sequences ENSMMUP00000010494 9544.ENSMMUP00000010494 ENSMMUP00000010494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]