SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010497 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000010497
Domain Number - Region: 21-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family EGF-type module 0.072
Further Details:      
 
Domain Number - Region: 108-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number - Region: 456-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0195
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 192-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family Laminin-type module 0.064
Further Details:      
 
Domain Number - Region: 341-483
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.033
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number - Region: 64-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0681
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010497   Gene: ENSMMUG00000008007   Transcript: ENSMMUT00000011197
Sequence length 486
Comment pep:novel chromosome:MMUL_1:7:44419288:44474077:-1 gene:ENSMMUG00000008007 transcript:ENSMMUT00000011197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFQC
SQRCDCYNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHP
VTGACACQPGWSGRHCNESCPAGYYGDGCQQTCTCQNGADCHSITGGCTCAPGFMGEVCA
VSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCT
CANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCL
AGWTGIRCDSTCPSGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICDPGFY
GHSCAQPCPLCVHSSGPCHHVSGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGT
CSPIDGSCQCFPGWIGKDCSQGCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQ
HCEQSK
Download sequence
Identical sequences ENSMMUP00000010497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]