SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010524 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000010524
Domain Number - Region: 30-84
Classification Level Classification E-value
Superfamily FnI-like domain 0.00753
Family Fibronectin type I module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010524   Gene: ENSMMUG00000008023   Transcript: ENSMMUT00000011226
Sequence length 114
Comment pep:known chromosome:MMUL_1:9:46601522:46613935:1 gene:ENSMMUG00000008023 transcript:ENSMMUT00000011226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVLLGGFVIFATFVTLCNASCSFIPNERFPGDSTRECTDLKGNKHPINSKWKTDNCERC
TCYKTEIICCTLIATPVGYDKKKCQRIFKKEDCKYIVVEKKNPKKTCPIDQWIL
Download sequence
Identical sequences A0A2K5WFL6 P25142
NP_001040596.1.72884 XP_015311483.1.63531 9544.ENSMMUP00000010524 ENSMMUP00000010524 ENSMMUP00000010524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]