SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010627 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010627
Domain Number 1 Region: 143-330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.07e-38
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 2 Region: 33-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.08e-36
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00067
Further Details:      
 
Domain Number 3 Region: 967-1020,1082-1216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.17e-32
Family Laminin G-like module 0.0041
Further Details:      
 
Domain Number 4 Region: 335-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-31
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 5 Region: 777-959
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6e-28
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 6 Region: 571-628
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000124
Family Fibrinogen C-terminal domain-like 0.0027
Further Details:      
 
Domain Number 7 Region: 542-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010627   Gene: ENSMMUG00000006091   Transcript: ENSMMUT00000011339
Sequence length 1382
Comment pep:known chromosome:MMUL_1:16:52805047:52822108:1 gene:ENSMMUG00000006091 transcript:ENSMMUT00000011339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRLRLFCILLAAVSEAEGWGYYGCDEELVGPLYARSLGASSYYSLLTAPRFARLHGISG
WSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHN
STFFGNVNESALVRHDLHYHFTARYIRIVPLAWNPRGKIGLRLGLYGCPYKSDILYFDGD
DAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHAEGAQGDYVTIELEGAHLLLHMSLGS
SPIQPRPGHTTVSAGGVLNDQHWHYVRVDRFGRDVNFTLDGYVQRFILNGDFERLNLDTE
MFIGGLVGAARKNLAYRHNFRGCIENVIFNRVNIADLAVRRHSRITFEATVAFRCLDPVP
HPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSRLGDGLGHVELTLSEGQVN
VSIAQSGRKKLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTGT
SYFFGGCPKPASRWDCHSNQTAFHGCMELLKVDGQLVNLTLVEFRRLGFYAEVLFDTCGI
TDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGETCHTPLYKESCEAYRLSGKTSGNFTI
DPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAIQYWNASWEEVS
ALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGLD
RSCVDPALYCNCDADQPQWRTDKGLLTFVDHLPVTQVVIGDTNRSTSEAQFFLRPLRCYG
DRNSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPYCQWRRPYVRV
ELNTSRDVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLRP
MPLQTYIWMEYDQPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTSPNCTGH
CAHPRLPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSA
AREFSHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPDYPRPGRPVPGYRGPVYNVT
GEEVSFSFSTSSAPAVLLYVSSFVRDYMAVLIKDDGTLQLRYQLGTSPYVYQLTTRPVTD
GQPHSVNITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQR
YNTPGFSGCLSGVRFNNVAPLKTHFRTPRPMTAELAEALRVQGELSESNCGAMPRLVSEV
PPELDPWYLPPDFPYYHDEGWVAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNEP
KAAHEYHPGSKPPLPTSGPAQAPTPTPAPTQAPASAPAPAPAPAPGPRDQNLPQILEESR
SE
Download sequence
Identical sequences ENSMMUP00000008006 ENSMMUP00000010627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]