SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010637 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010637
Domain Number 1 Region: 148-281
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-28
Family Cadherin 0.00078
Further Details:      
 
Domain Number 2 Region: 380-507
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-25
Family Cadherin 0.00081
Further Details:      
 
Domain Number 3 Region: 264-387
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000138
Family Cadherin 0.00035
Further Details:      
 
Domain Number 4 Region: 489-592
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000606
Family Cadherin 0.0045
Further Details:      
 
Domain Number 5 Region: 81-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000005
Family Cadherin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010637   Gene: ENSMMUG00000008123   Transcript: ENSMMUT00000011351
Sequence length 887
Comment pep:known chromosome:MMUL_1:10:4507455:4579452:-1 gene:ENSMMUG00000008123 transcript:ENSMMUT00000011351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMRSGSHPLLLLLLALLLWLLQVSIVDSVQQETDDLTKQTKPLRRSKRRWVITTLELEE
EDPGPFPKLIGELFNNMSDNMSLMYLLSGPGVDEYPEIGLFSLEDHENGRIYVHRPVDRE
TTPSFTVYFDVAERSTGKIVDKSLIFNIRISDVNDHAPQFPEKEFNITVQENQTAGQPIF
QMLAVDLDEENTPNSQVLYFLISQTPLLKESGFQVDRISGEIRLSGCLDYETAPQFTLLI
RARDCGEPSLSSTATVHMDVQENNNHRPIFTQENYKIQIPEGRVSKGVVRLLVQDRDSPF
TSAWRANFNILHGNEEGHFDILTDPETNEGILNVIKPLDYETCPARSLVIAVENEERLFY
CERGKLQPPRKAAASATVSVQVTDANDPPTFHPQSFIVSKKEGTGPGTLLGTFNATDPDS
QIRYKRVHDPANWVSVDENSGVVTTVEPIDRESPHVNDSFYIIIVHAVDDGFPPQTATGT
LMLFLSDINDNAPTLRPHSRYMEVCESAVHQPLHIEAEDPDLEPFSDPFTFELDNTLRNA
EDTWKLGKNWGQSVELLTLRSLPRGNYLVPLFIGDKQGLSQKQTVHVRICPCASGFTCVE
HADAGVGLLVGALSPVCAAFVALAVALLFLLRRYFVLEPKRHGCSISNDEGHQTLVMYNE
ESKATSAQTWSDVEGHRPALLVCIAAAGPKQGAKDLKEVPPSAASRAAQARSALGSWGYG
ELFESRGVENMYSTPAYPDATVHRQLLALVEGRMAETLNQSKVRNHFSLSRGCIIPQGRA
TAGRGLPQGIYKEMMVPRRLTQPGKRKHGALARTPSFKKVLCDLKEDEENKAGRKQKSHL
FKVTQLKNEWGLVQSAHSPSPLNKKPCFPGGCRGEWAGGHNCRAVSG
Download sequence
Identical sequences ENSMMUP00000010637 9544.ENSMMUP00000010637 ENSMMUP00000010636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]