SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010721 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010721
Domain Number 1 Region: 164-250
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.28e-22
Family D-aminoacid oxidase-like 0.0005
Further Details:      
 
Domain Number 2 Region: 28-177,238-295
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 6.47e-22
Family D-aminoacid oxidase, N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010721   Gene: ENSMMUG00000008185   Transcript: ENSMMUT00000011439
Sequence length 309
Comment pep:known_by_projection chromosome:MMUL_1:4:153548246:153571175:1 gene:ENSMMUG00000008185 transcript:ENSMMUT00000011439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPARHCKTSFGARDFGGFQDCFFRDRPMDTARIAVVGAGVVGLSTAVCISKLVPQCSVTI
ISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVS
GIKGSGGWMLTRRIDDLWELYPSFDIVVNCSGLGSRQLAGDANIFPVRGQVLQVQAPWVE
HFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIR
EKVGLRPYRPGVRLQTELLARDGRRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHAL
RTPIPKSKL
Download sequence
Identical sequences ENSMMUP00000010721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]