SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010739 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010739
Domain Number 1 Region: 62-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000182
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 2 Region: 170-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000745
Family EGF-type module 0.034
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010739
Domain Number - Region: 118-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000226
Family Laminin-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010739   Gene: ENSMMUG00000008197   Transcript: ENSMMUT00000011457
Sequence length 209
Comment pep:known chromosome:MMUL_1:1:110305543:110392963:1 gene:ENSMMUG00000008197 transcript:ENSMMUT00000011457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIPKGTANTCIPSISSIGNPPKFNRIWPNISSLEVSNPKQVAPKLALSTVSSVQVANHKR
DCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIECYC
NPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTCHN
NVRCLCPAAYTGILCEKLRCEEAGSCGSD
Download sequence
Identical sequences Q5IEC3
ENSMMUP00000010739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]