SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010810 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010810
Domain Number 1 Region: 73-148
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.11e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000311
Further Details:      
 
Domain Number 2 Region: 264-339
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.36e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000612
Further Details:      
 
Domain Number 3 Region: 169-258
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.94e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000433
Further Details:      
 
Domain Number 4 Region: 2-69
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000928
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010810   Gene: ENSMMUG00000008249   Transcript: ENSMMUT00000011531
Sequence length 461
Comment pep:known_by_projection chromosome:MMUL_1:15:8183610:8242999:-1 gene:ENSMMUG00000008249 transcript:ENSMMUT00000011531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGFIIGRGGEQISRIQAESGCKIQIASESSGIPERPCVLTGTPESIEQAKRLLGQIVDR
CRNGPGFHNDIDSNSTIQEILIPASKVGLVIGRGGETIKQLQERTGVKMVMIQDGPLPTG
ADKPLRITGDAFKVQQAREMVLEIIREKDQADFRGVRGDFSSRVGGGSIEVSVPRFAVGI
VIGRNGEMIKKIQNDAGVRIQFKPDDGISPERAAQVMGPPDRCQHAAHIISELILTAQER
DGFGGLAAARGRGRGRGDWSVGAPGGVQEITYTVPADKCGLVIGKGGENIKSINQQSGAH
VELQRNPPPNSDPNLRRFTIRGVPQQIEVARQLIDEKVGGTNLGAPGAFGQSPFSQPPAP
PHQNTFPPRSSGCFPNMAAKVNGNPHSTPVSGPPAFLTQGWGSTYQAWQQPTQQVPSHAA
SAAPQASSPPDYTMAWAEYYRQQVAFYGQTLGQAQAHSQEQ
Download sequence
Identical sequences ENSMMUP00000010810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]