SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010811 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010811
Domain Number 1 Region: 100-175
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000311
Further Details:      
 
Domain Number 2 Region: 12-96
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.84e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000326
Further Details:      
 
Domain Number 3 Region: 196-259
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000013
Family Eukaryotic type KH-domain (KH-domain type I) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010811   Gene: ENSMMUG00000008249   Transcript: ENSMMUT00000011532
Sequence length 261
Comment pep:known_by_projection chromosome:MMUL_1:15:8185868:8211645:-1 gene:ENSMMUG00000008249 transcript:ENSMMUT00000011532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FATVGNQLGALVHQRTVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGI
PERPCVLTGTPESIEQAKRLLGQIVDRCRNGPGFHNDIDSNSTIQEILIPASKVGLVIGR
GGETIKQLQERTGVKMVMIQDGPLPTGADKPLRITGDAFKVQQAREMVLEIIREKDQADF
RGVRGDFSSRVGGGSIEVSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPADSHSPEYY
RQQVAFYGQTLGQAQAHSQVC
Download sequence
Identical sequences ENSMMUP00000010811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]