SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010873 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010873
Domain Number 1 Region: 64-255
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.17e-69
Family Glutathione peroxidase-like 0.0000000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010873   Gene: ENSMMUG00000008294   Transcript: ENSMMUT00000011598
Sequence length 256
Comment pep:known chromosome:MMUL_1:9:118789136:118800061:-1 gene:ENSMMUG00000008294 transcript:ENSMMUT00000011598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVGRLLRASVTRHVSAIPWGISATAALRPAACRRTSLTNLLCSGSSQAKLFSTSSSY
HAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKAN
EFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPG
LALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPADWTPDSPTI
KPNPAASKEYFQKVNQ
Download sequence
Identical sequences A0A1D5Q4H6
ENSMMUP00000010873 ENSMMUP00000010873 9544.ENSMMUP00000010873 NP_001252755.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]