SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010931 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010931
Domain Number 1 Region: 28-193
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.32e-17
Family N-acetyl transferase, NAT 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010931   Gene: ENSMMUG00000008335   Transcript: ENSMMUT00000011658
Sequence length 200
Comment pep:known chromosome:MMUL_1:X:21583784:21586771:1 gene:ENSMMUG00000008335 transcript:ENSMMUT00000011658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEPPPPTIQVQGPGPQREEKQKTKMAKFVIRPATAADCSDILRLIKELAKYEYMEEQVIL
TEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGNPSPFTEARETECYVRSSYQSALLYLED
FFVMSDYRGTIELWHRIRNSEESKPGCDEVSLAACTSWAEWNEPSINFYKRRGASDLSSE
EGWRLFKIDKQYLLKMATEE
Download sequence
Identical sequences ENSMMUP00000010931 ENSMMUP00000010931 9544.ENSMMUP00000010931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]