SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010967 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010967
Domain Number 1 Region: 453-576
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-28
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 234-357
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-28
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 131-238
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-23
Family Cadherin 0.0054
Further Details:      
 
Domain Number 4 Region: 347-457
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-19
Family Cadherin 0.0052
Further Details:      
 
Domain Number 5 Region: 570-675
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000228
Family Cadherin 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010967
Domain Number - Region: 30-129
Classification Level Classification E-value
Superfamily Cadherin-like 0.000267
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010967   Gene: ENSMMUG00000008362   Transcript: ENSMMUT00000011695
Sequence length 1135
Comment pep:known chromosome:MMUL_1:5:129951347:129962660:-1 gene:ENSMMUG00000008362 transcript:ENSMMUT00000011695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQMNAKMHFRFVFALLIVSFNRDVLGKNLKYRIYEEQRVGSVIARLSEDVADVLLKLPN
PSTVRFRAMQRGNSPLLVVNEDNGEISIGATIDREQLCQKNLNCSIEFDVITLPTEHLQL
FHIEVEVLDINDNSPQFSRSLIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSAND
FFNIEVRTRTDGAKYAELIVVRELDRELKSSYELQLTASDMGVPQRSGSSILKISISDSN
DNSPAFEQQSYIIQLLENSPVGTLLLDLNATDPDEGANGKIVYSFSSHVSPKIMETFKID
SERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEININLMS
PGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFKLQKTYENNYLILTN
ATLDREKRSEYSLTVIAEDKGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSP
GAYITTVTAIDPDLGENGQVTYTILESFILGSSITTYVTIDPSNGAIYALRIFDHEEVSQ
ITFVVEARDGGSPKQLVSNTTVVLTIIDENDNIPVVIGPALRNNTAEITIPKGAESGFHV
TRIRAIDRDSGVNAELSCAIVAGNEENIFIIDPRSCDIHTNVSMDSVPYTEWELSVIIQD
KGNPQLHTKVLLKCMIFEYAESVTSTAMTSVSQASLDVSMIIIISLGAICAVLLVIMVLF
ATRCNREKKDTRSYNCRVAESTYQHHPKRPSRQIHKGDITLVPTINGTLPIRSHHRSSPS
SSPTLERGQMGSRQSHNSHQSLNSLVTISSNHVPENFSLELTHATPAVEQVSQLLSMLHQ
GQYQPRPSFRGNKYSRSYRYALQDMDKFSLKDSGRGDSEAGDSDYDLGRDSPIDRLLGEG
FSDLFLTDGRIPAAMRLCTEECRVLGHSDQCWMPPLPSPSSDYRSNMFIPGEEFPTQPQQ
QHPHQSLEDDAQPADSGEKKKSFSTFGKDSPNDEDTGDTSTSSLLSEMSSVFQRLLPPSL
DTYSECSEVDRSNSLERRKGPLPAKTVGYPQGVAAWAASTHFQNPTNNCGPPLGTHSSVQ
PSSKWLPAMEEIPENYEEDDFDNVLNHLNDGKHELMDASELVAEINKLLQDVRQS
Download sequence
Identical sequences F7HPU3
ENSMMUP00000010967 9544.ENSMMUP00000010967 XP_001086925.2.72884 ENSMMUP00000010967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]