SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010973 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010973
Domain Number 1 Region: 231-366
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-34
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 8.38e-24
Family Cadherin 0.0067
Further Details:      
 
Domain Number 3 Region: 341-444
Classification Level Classification E-value
Superfamily Cadherin-like 6.15e-23
Family Cadherin 0.0048
Further Details:      
 
Domain Number 4 Region: 504-619
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-18
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 444-496
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000328
Family Cadherin 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010973
Domain Number - Region: 32-97
Classification Level Classification E-value
Superfamily Cadherin-like 0.000128
Family Cadherin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010973   Gene: ENSMMUG00000008368   Transcript: ENSMMUT00000011701
Sequence length 753
Comment pep:known_by_projection chromosome:MMUL_1:6:137608487:137610883:1 gene:ENSMMUG00000008368 transcript:ENSMMUT00000011701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASGKLICRQRQVLFHFLLLGFSLAGAAEPRRYSVVEETEGSSFVTNLAKDLGLEQREF
SRRGVRVVSRGNKLHLQLNQKTGDLLLNEKLDREDLCGHTEPCALHFQVLLESPFEFFQA
ELQVIDINDHSPVFLDKEMLVKVSESSPPGTTFPLKNAEDLDVGQNNIENYIISPNSYFR
VLTRKRSDGRKYPELVLDKALDREAEAELRLTLTALDGGSPPRSGTAQVYIEVLDVNDNA
PEFEQPFYRVQISEDSPIGFLVVKVSATDVDTGVNGEISYSLFQASDEISKTFKVDSLTG
EIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVMDVNDHAPEVTMSAFTSPIPEN
APETVVALFSVSDLDSGENGEISCSIQEDLPFLLKSAENFYTLLTERPLDRESRGEYNIT
ITVTDLGTPMLKTQLNITVLVADVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDS
GTNAQVTYSLLPPQDAHLEALVRVLVLDANDNSPFVLYPPQNGSAPCIELVPRAAEPGYL
VTKVVAVDGDSGQNAWLSYQLLKATELGLFGVRAHNGEVRTARLLSERDAAKHRLVVLVK
DNGEPPRSATATLHVLLVDGFSQPYLPLPGATPAQAQADSLTIYLVVALASVSSLFLLSV
LLFVAVRLCRRSMAASVGRCSVPKGPFRGHLVDVSGTGTLSQSYQYEVCLAGGSGTNEFK
FLKPIIPDFPPQCPGKEIQGNATFSNDFGFNIQ
Download sequence
Identical sequences NP_001181814.1.72884 ENSMMUP00000010973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]