SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011016 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011016
Domain Number 1 Region: 94-324,361-417
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.27e-48
Family LacY-like proton/sugar symporter 0.064
Further Details:      
 
Domain Number 2 Region: 537-679
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.83e-20
Family Glycerol-3-phosphate transporter 0.052
Further Details:      
 
Domain Number 3 Region: 442-520
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000000811
Family Pentapeptide repeats 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011016   Gene: ENSMMUG00000008399   Transcript: ENSMMUT00000011747
Sequence length 683
Comment pep:known chromosome:MMUL_1:7:71075615:71150480:1 gene:ENSMMUG00000008399 transcript:ENSMMUT00000011747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDYKYQDNYGGYAPSDGYYRGNESNPEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVK
AKQAKMAPSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGRFQWILFFVLGLALM
ADGVEVFVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRKRVLSM
SLAVNASFASLSSFVQGYGAFLFCRLISGIGIGGALPIVFAYFSEFLSREKRGEHLSWLG
IFWMTGGLYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPCTVSMVALKFMPES
PRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSNIKTPKQMDEFIEIQSSTGTWY
QRWLVRFKTIFKQVWDNALYCVMGPYRMNTLILAVVWFAMALSYYGLTVWFPDMIRYFQD
EEYKSKMKVFFGEHVYGATINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFE
DVTSTDTYFKNCTIESTIFYNTDLYEHKFINCRFINSTFLEQKEGCHMDLEQDNDFLIYL
VSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFC
GTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLA
AASLVGGGLIALRLPETREQVLM
Download sequence
Identical sequences A0A0D9RWS7 H9EMI4
9544.ENSMMUP00000011016 NP_001247558.1.72884 XP_007988666.1.81039 XP_007988667.1.81039 XP_014998540.1.72884 XP_014998541.1.72884 ENSMMUP00000011016 ENSMMUP00000011016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]