SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011041 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000011041
Domain Number - Region: 814-968
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00245
Family Pentapeptide repeats 0.013
Further Details:      
 
Domain Number - Region: 981-1084
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0562
Family Pentapeptide repeats 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011041   Gene: ENSMMUG00000008422   Transcript: ENSMMUT00000011774
Sequence length 1335
Comment pep:known chromosome:MMUL_1:X:53249487:53258030:1 gene:ENSMMUG00000008422 transcript:ENSMMUT00000011774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTLLAATKDSLAVDPPVVSRPKKSKTKKAPIKAITKAAPAAPPVPTANEIATNKPKITL
QALNLPVITQISQASPTTEVTNTQVSSVTAQPKKANKMKRVTAKAAQGSQSPTGREGGAT
QLKSPLQVLNLPVISQNIHASIANESASSQTLITSIKPKKASKAKKAANKAIASATEVSL
APTATHTATTQGQITNETASIHTTAASIRTKKASKARKIIAKVINTDTEHIQAANVTETA
TRQIEASVIAIRPKKSKGKKAASRGPNSVSEISEALLATQMVTNQALAATLRVKRGSRAR
KASTKARATESQTPNADQGAQAKMASAQTNVSALETQVAAAVQALADDYLAQLSLEPTTR
TRGKRNRKSKHLNGDERSGNNYRRIPWGRRPAPPRDVAILQERANKLVKYLLVKDQTKIP
IKRSDMLRDVIQEYDEYFPEIIERASYALEKMFRVNLKEIDKQSSLYILISTRESSAGIL
GTTKDTPKLGLLMVILSVIFMNGNKASEAVIWEVLRKLGLHPGVRHSLFGEVRKLITDEF
VKQKYLEYKRVPNSRPPEYEFFWGLRSYHETSKMKVLKFACKVQKKDPKDWAVQYREAVE
MEVQAAAVAVAEAEARAEARAQMGIGEEAVAGPWNWDDMDIDCLTREELGDDAQAWSRFS
FEIEARAQENADASTSVNFSRGAGTRAGFSDGASISFNGAPSSSGGPGITFGGAPSSSAS
FSNTASISFGGTLSTSSSFSSAASISFGGAPSTSTSFSSEASISFGGTPCTSASFSGGVS
SSFSGPLNTSATFSGAASSGFGGTLSTTAGFSSVLSTSTSFGSAPTTNTVFSSALSTSTG
FGGTLSTSVCFGGSPSSSGSFGGTLSTSICFGGSPCTSTGFGGTLSTSVSFGGPSSTSAN
CGGTLSTSICFDGSPSTGAGFGGALNTSASFGSALNTSAGFGGAMSTSADFGSTLSTSVC
FGGSPGTSVSFGSALNTSTSAGFSGAVGTSAGFSGVPSTNPGFGGAFNTSAGFGGALSTT
TDFGGTPNNSIGFGAAPSTSVSFGGAHSTSLCFGGAPSTSLCFGSASNTNLCFGGPPSTS
ACFSGATSPSFGDGPSTSTGFSFGNGLSTSAGFGGGLNTSAGFGGGLGTSAGFSGDLSTS
SGFDGGLGTSAGFSGGPGTSTGFGGGLGTSAGFSGGLGTGAGFGGGLVTSDGFGGGLGTN
ASFGSTLGTGAGFSGGLSTSDGFGSRPNASFDRGLSTIIGFGSGSNTSTGFIGEPSTSTG
FHSGPSSIVGFSGGPSTGVGFCSGPSISGFSGGPSTGAGFGGGPNTGAGFGGGPSTSAGF
GSGATSLGACGFSYG
Download sequence
Identical sequences ENSMMUP00000011041 9544.ENSMMUP00000011041 ENSMMUP00000027800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]